DKK3 (NM_015881) Human Recombinant Protein
CAT#: TP321022
Recombinant protein of human dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 1, 20 µg
View other "DKK3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221022 protein sequence
Red=Cloning site Green=Tags(s) MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVE EMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEE GRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDN QRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSL VYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMALGEPAAAAAALLGGEEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056965 |
| Locus ID | 27122 |
| UniProt ID | Q9UBP4 |
| Refseq Size | 2769 |
| Cytogenetics | 11p15.3 |
| Refseq ORF | 1050 |
| Synonyms | REIC; RIG |
| Summary | This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402468 | DKK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415712 | DKK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422711 | DKK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402468 | Transient overexpression lysate of dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 1 |
CNY 3080.00 |
|
| LY415712 | Transient overexpression lysate of dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 2 |
CNY 3080.00 |
|
| LY422711 | Transient overexpression lysate of dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 3 |
CNY 3080.00 |
|
| PH321022 | DKK3 MS Standard C13 and N15-labeled recombinant protein (NP_056965) |
CNY 19520.00 |
|
| TP720348 | Recombinant protein of human dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 3 |
CNY 1800.00 |

