DKK3 (NM_015881) Human Mass Spec Standard
CAT#: PH321022
DKK3 MS Standard C13 and N15-labeled recombinant protein (NP_056965)
View other "DKK3" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DKK3 MS Standard C13 and N15-labeled recombinant protein (NP_056965) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221022 |
Predicted MW | 38.3 kDa |
Protein Sequence |
>RC221022 protein sequence
Red=Cloning site Green=Tags(s) MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVE EMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEE GRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDN QRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSL VYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMALGEPAAAAAALLGGEEI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056965 |
RefSeq Size | 2769 |
RefSeq ORF | 1050 |
Synonyms | REIC; RIG |
Locus ID | 27122 |
Cytogenetics | 11p15.3 |
Summary | This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402468 | DKK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415712 | DKK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422711 | DKK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402468 | Transient overexpression lysate of dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 1 |
CNY 3080.00 |
|
LY415712 | Transient overexpression lysate of dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 2 |
CNY 3080.00 |
|
LY422711 | Transient overexpression lysate of dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 3 |
CNY 3080.00 |
|
TP321022 | Recombinant protein of human dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720348 | Recombinant protein of human dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 3 |
CNY 1800.00 |