Kallikrein 9 (KLK9) (NM_012315) Human Recombinant Protein
CAT#: TP320945
Recombinant protein of human kallikrein-related peptidase 9 (KLK9), 20 µg
View other "Kallikrein 9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220945 representing NM_012315
Red=Cloning site Green=Tags(s) MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRKPYLW VRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPG MQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVC NGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEIMEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036447 |
Locus ID | 284366 |
UniProt ID | Q9UKQ9 |
Refseq Size | 1438 |
Cytogenetics | 19q13.41 |
Refseq ORF | 750 |
Synonyms | KLK-L3; KLKL3 |
Summary | The protein encoded by this gene is a kallikrein-related serine protease. This gene is activated by steroid hormones in a human breast cancer cell line, making it a good marker for cancer detection. The encoded protein is found primarily in the cytoplasm.[provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402192 | KLK9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402192 | Transient overexpression lysate of kallikrein-related peptidase 9 (KLK9) |
CNY 3080.00 |
|
PH320945 | KLK9 MS Standard C13 and N15-labeled recombinant protein (NP_036447) |
CNY 19520.00 |
其它Kallikrein 9产品