Kallikrein 9 (KLK9) (NM_012315) Human Mass Spec Standard
CAT#: PH320945
KLK9 MS Standard C13 and N15-labeled recombinant protein (NP_036447)
View other "Kallikrein 9" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | KLK9 MS Standard C13 and N15-labeled recombinant protein (NP_036447) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220945 |
| Predicted MW | 27.3 kDa |
| Protein Sequence |
>RC220945 representing NM_012315
Red=Cloning site Green=Tags(s) MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRKPYLW VRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPG MQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVC NGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEIMEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036447 |
| RefSeq Size | 1438 |
| RefSeq ORF | 750 |
| Synonyms | KLK-L3; KLKL3 |
| Locus ID | 284366 |
| Cytogenetics | 19q13.41 |
| Summary | The protein encoded by this gene is a kallikrein-related serine protease. This gene is activated by steroid hormones in a human breast cancer cell line, making it a good marker for cancer detection. The encoded protein is found primarily in the cytoplasm.[provided by RefSeq, Oct 2010] |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402192 | KLK9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402192 | Transient overexpression lysate of kallikrein-related peptidase 9 (KLK9) |
CNY 3080.00 |
|
| TP320945 | Recombinant protein of human kallikrein-related peptidase 9 (KLK9), 20 µg |
CNY 2900.00 |
其它Kallikrein 9产品
