CT45A2 (NM_152582) Human Recombinant Protein
CAT#: TP320942
Recombinant protein of human cancer/testis antigen family 45, member A2 (CT45A2), 20 µg
View other "CT45A2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220942 representing NM_152582
Red=Cloning site Green=Tags(s) MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_689795 |
| Locus ID | 728911 |
| UniProt ID | Q5DJT8 |
| Refseq Size | 1032 |
| Cytogenetics | Xq26.3 |
| Refseq ORF | 567 |
| Synonyms | CT45-2; CT45.2; CT45A8; CT45A9 |
| Summary | This gene represents one of a cluster of several similar genes located on the q arm of chromosome X. The genes in this cluster encode members of the cancer/testis (CT) family of antigens, and are distinct from other CT antigens. These antigens are thought to be novel therapeutic targets for human cancers. [provided by RefSeq, Apr 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403478 | CT45A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403478 | Transient overexpression lysate of cancer/testis antigen family 45, member A2 (CT45A2) |
CNY 3080.00 |
|
| PH320942 | CT45A2 MS Standard C13 and N15-labeled recombinant protein (NP_689795) |
CNY 19520.00 |
