CT45A2 (NM_152582) Human Mass Spec Standard
CAT#: PH320942
CT45A2 MS Standard C13 and N15-labeled recombinant protein (NP_689795)
View other "CT45A2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | CT45A2 MS Standard C13 and N15-labeled recombinant protein (NP_689795) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220942 |
Predicted MW | 21.1 kDa |
Protein Sequence |
>RC220942 representing NM_152582
Red=Cloning site Green=Tags(s) MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_689795 |
RefSeq Size | 1032 |
RefSeq ORF | 567 |
Synonyms | CT45-2; CT45.2; CT45A8; CT45A9 |
Locus ID | 728911 |
Cytogenetics | Xq26.3 |
Summary | This gene represents one of a cluster of several similar genes located on the q arm of chromosome X. The genes in this cluster encode members of the cancer/testis (CT) family of antigens, and are distinct from other CT antigens. These antigens are thought to be novel therapeutic targets for human cancers. [provided by RefSeq, Apr 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403478 | CT45A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403478 | Transient overexpression lysate of cancer/testis antigen family 45, member A2 (CT45A2) |
CNY 3080.00 |
|
TP320942 | Recombinant protein of human cancer/testis antigen family 45, member A2 (CT45A2), 20 µg |
CNY 2900.00 |