NAP1L1 (NM_004537) Human Recombinant Protein
CAT＃: TP320821
Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2, 20 µg
View other "NAP1L1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220821 representing NM_004537
Red=Cloning site Green=Tags(s) MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 45.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004528 |
| Locus ID | 4673 |
| UniProt ID | P55209 |
| Refseq Size | 2908 |
| Cytogenetics | 12q21.2 |
| Refseq ORF | 1173 |
| Synonyms | NAP1; NAP1L; NRP |
| Summary | This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. [provided by RefSeq, Apr 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408353 | NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417929 | NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408353 | Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1 |
CNY 3080.00 |
|
| LY417929 | Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2 |
CNY 3080.00 |
|
| PH301851 | NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_631946) |
CNY 19520.00 |
|
| PH320821 | NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_004528) |
CNY 19520.00 |
|
| TP301851 | Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1, 20 µg |
CNY 2900.00 |
