NAP1L1 (NM_139207) Human Recombinant Protein
CAT#: TP301851
Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1, 20 µg
View other "NAP1L1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201851 protein sequence
Red=Cloning site Green=Tags(s) MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_631946 |
Locus ID | 4673 |
UniProt ID | P55209 |
Refseq Size | 4451 |
Cytogenetics | 12q21.2 |
Refseq ORF | 1173 |
Synonyms | NAP1; NAP1L; NRP |
Summary | This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. [provided by RefSeq, Apr 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408353 | NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417929 | NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408353 | Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1 |
CNY 3080.00 |
|
LY417929 | Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2 |
CNY 3080.00 |
|
PH301851 | NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_631946) |
CNY 19520.00 |
|
PH320821 | NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_004528) |
CNY 19520.00 |
|
TP320821 | Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2, 20 µg |
CNY 2900.00 |