SYCE1 (NM_130784) Human Recombinant Protein
CAT#: TP320187
Purified recombinant protein of Homo sapiens synaptonemal complex central element protein 1 (SYCE1), transcript variant 1, 20 µg
View other "SYCE1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220187 representing NM_130784
Red=Cloning site Green=Tags(s) MEMVQKLQKVGSLEPRVEVLINRINEVQQAKKKANKDLGEARTICEALQKELDSLHGEKVHLKEILSKKQ ETLRILRLHCQEKESEAHRKHTMLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFH MPERLAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEE HRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVAPRPGRPVTW WS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_570140 |
| Locus ID | 93426 |
| UniProt ID | Q8N0S2 |
| Refseq Size | 1400 |
| Cytogenetics | 10q26.3 |
| Refseq ORF | 846 |
| Synonyms | C10orf94; CT76; POF12; SPGF15 |
| Summary | This gene encodes a member of the synaptonemal complex, which links homologous chromosomes during prophase I of meiosis. The tripartite structure of the complex is highly conserved amongst metazoans. It consists of two lateral elements and a central region formed by transverse elements and a central element. The protein encoded by this gene localizes to the central element and is required for initiation and elongation of the synapsis. Allelic variants of this gene have been associated with premature ovarian failure and spermatogenic failure. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408943 | SYCE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428328 | SYCE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428329 | SYCE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408943 | Transient overexpression lysate of synaptonemal complex central element protein 1 (SYCE1), transcript variant 1 |
CNY 3080.00 |
|
| LY428328 | Transient overexpression lysate of synaptonemal complex central element protein 1 (SYCE1), transcript variant 3 |
CNY 3080.00 |
|
| LY428329 | Transient overexpression lysate of synaptonemal complex central element protein 1 (SYCE1), transcript variant 4 |
CNY 3080.00 |
|
| PH320187 | SYCE1 MS Standard C13 and N15-labeled recombinant protein (NP_570140) |
CNY 14250.00 |
