SYCE1 (NM_130784) Human Mass Spec Standard
CAT#: PH320187
SYCE1 MS Standard C13 and N15-labeled recombinant protein (NP_570140)
View other "SYCE1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | SYCE1 MS Standard C13 and N15-labeled recombinant protein (NP_570140) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220187 |
| Predicted MW | 32.4 kDa |
| Protein Sequence |
>RC220187 representing NM_130784
Red=Cloning site Green=Tags(s) MEMVQKLQKVGSLEPRVEVLINRINEVQQAKKKANKDLGEARTICEALQKELDSLHGEKVHLKEILSKKQ ETLRILRLHCQEKESEAHRKHTMLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFH MPERLAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEE HRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVAPRPGRPVTW WS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_570140 |
| RefSeq Size | 1400 |
| RefSeq ORF | 846 |
| Synonyms | C10orf94; CT76; POF12; SPGF15 |
| Locus ID | 93426 |
| Cytogenetics | 10q26.3 |
| Summary | This gene encodes a member of the synaptonemal complex, which links homologous chromosomes during prophase I of meiosis. The tripartite structure of the complex is highly conserved amongst metazoans. It consists of two lateral elements and a central region formed by transverse elements and a central element. The protein encoded by this gene localizes to the central element and is required for initiation and elongation of the synapsis. Allelic variants of this gene have been associated with premature ovarian failure and spermatogenic failure. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408943 | SYCE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428328 | SYCE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428329 | SYCE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408943 | Transient overexpression lysate of synaptonemal complex central element protein 1 (SYCE1), transcript variant 1 |
CNY 3080.00 |
|
| LY428328 | Transient overexpression lysate of synaptonemal complex central element protein 1 (SYCE1), transcript variant 3 |
CNY 3080.00 |
|
| LY428329 | Transient overexpression lysate of synaptonemal complex central element protein 1 (SYCE1), transcript variant 4 |
CNY 3080.00 |
|
| TP320187 | Purified recombinant protein of Homo sapiens synaptonemal complex central element protein 1 (SYCE1), transcript variant 1, 20 µg |
CNY 2900.00 |
