CDC42SE1 (NM_020239) Human Recombinant Protein
CAT#: TP319709
Recombinant protein of human CDC42 small effector 1 (CDC42SE1), transcript variant 2, 20 µg
View other "CDC42SE1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219709 protein sequence
Red=Cloning site Green=Tags(s) MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRD RPWSNSRGL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064624 |
Locus ID | 56882 |
UniProt ID | Q9NRR8 |
Refseq Size | 3057 |
Cytogenetics | 1q21.3 |
Refseq ORF | 237 |
Synonyms | SCIP1; SPEC1 |
Summary | Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412574 | CDC42SE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422010 | CDC42SE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412574 | Transient overexpression lysate of CDC42 small effector 1 (CDC42SE1), transcript variant 2 |
CNY 3080.00 |
|
LY422010 | Transient overexpression lysate of CDC42 small effector 1 (CDC42SE1), transcript variant 1 |
CNY 3080.00 |
|
PH319709 | CDC42SE1 MS Standard C13 and N15-labeled recombinant protein (NP_064624) |
CNY 19520.00 |
其它CDC42SE1产品