CDC42SE1 (NM_020239) Human Mass Spec Standard
CAT#: PH319709
CDC42SE1 MS Standard C13 and N15-labeled recombinant protein (NP_064624)
View other "CDC42SE1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | CDC42SE1 MS Standard C13 and N15-labeled recombinant protein (NP_064624) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219709 |
Predicted MW | 8.9 kDa |
Protein Sequence |
>RC219709 protein sequence
Red=Cloning site Green=Tags(s) MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRD RPWSNSRGL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_064624 |
RefSeq Size | 3057 |
RefSeq ORF | 237 |
Synonyms | SCIP1; SPEC1 |
Locus ID | 56882 |
Cytogenetics | 1q21.3 |
Summary | Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412574 | CDC42SE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422010 | CDC42SE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412574 | Transient overexpression lysate of CDC42 small effector 1 (CDC42SE1), transcript variant 2 |
CNY 3080.00 |
|
LY422010 | Transient overexpression lysate of CDC42 small effector 1 (CDC42SE1), transcript variant 1 |
CNY 3080.00 |
|
TP319709 | Recombinant protein of human CDC42 small effector 1 (CDC42SE1), transcript variant 2, 20 µg |
CNY 2900.00 |
其它CDC42SE1产品