NUDT2 (NM_147173) Human Recombinant Protein
CAT#: TP319598
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 3, 20 µg
View other "NUDT2" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219598 representing NM_147173
Red=Cloning site Green=Tags(s) MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ FLCSIEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_671702 |
Locus ID | 318 |
UniProt ID | P50583 |
Refseq Size | 978 |
Cytogenetics | 9p13.3 |
Refseq ORF | 441 |
Synonyms | APAH1 |
Summary | This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. [provided by RefSeq, Sep 2011] |
Protein Pathways | Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403446 | NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407737 | NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420095 | NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403446 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 3 |
CNY 3080.00 |
|
LY407737 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 2 |
CNY 3080.00 |
|
LY420095 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 1 |
CNY 3080.00 |
|
PH302439 | NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671701) |
CNY 19520.00 |
|
PH319598 | NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671702) |
CNY 19520.00 |
|
TP302439 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 2, 20 µg |
CNY 2900.00 |