NUDT2 (NM_147172) Human Mass Spec Standard
CAT#: PH302439
NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671701)
View other "NUDT2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671701) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202439 |
| Predicted MW | 16.8 kDa |
| Protein Sequence |
>RC202439 protein sequence
Red=Cloning site Green=Tags(s) MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ FLCSIEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_671701 |
| RefSeq Size | 1020 |
| RefSeq ORF | 441 |
| Synonyms | APAH1 |
| Locus ID | 318 |
| Cytogenetics | 9p13.3 |
| Summary | This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. [provided by RefSeq, Sep 2011] |
| Protein Pathways | Purine metabolism, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403446 | NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407737 | NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420095 | NUDT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403446 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 3 |
CNY 3080.00 |
|
| LY407737 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 2 |
CNY 3080.00 |
|
| LY420095 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 1 |
CNY 3080.00 |
|
| PH319598 | NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671702) |
CNY 19520.00 |
|
| TP302439 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP319598 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 3, 20 µg |
CNY 2900.00 |
