HCST (NM_001007469) Human Recombinant Protein
CAT#: TP319253
Recombinant protein of human hematopoietic cell signal transducer (HCST), transcript variant 2, 20 µg
View other "HCST" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219253 protein sequence
Red=Cloning site Green=Tags(s) MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFL CARPRRSPAQEDGKVYINMPGRG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001007470 |
Locus ID | 10870 |
UniProt ID | Q9UBK5 |
Refseq Size | 521 |
Cytogenetics | 19q13.12 |
Refseq ORF | 279 |
Synonyms | DAP10; KAP10; PIK3AP |
Summary | This gene encodes a transmembrane signaling adaptor that contains a YxxM motif in its cytoplasmic domain. The encoded protein may form part of the immune recognition receptor complex with the C-type lectin-like receptor NKG2D. As part of this receptor complex, this protein may activate phosphatidylinositol 3-kinase dependent signaling pathways through its intracytoplasmic YxxM motif. This receptor complex may have a role in cell survival and proliferation by activation of NK and T cell responses. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402299 | HCST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423490 | HCST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402299 | Transient overexpression lysate of hematopoietic cell signal transducer (HCST), transcript variant 1 |
CNY 3080.00 |
|
LY423490 | Transient overexpression lysate of hematopoietic cell signal transducer (HCST), transcript variant 2 |
CNY 3080.00 |
|
PH319253 | HCST MS Standard C13 and N15-labeled recombinant protein (NP_001007470) |
CNY 19520.00 |