HCST (NM_001007469) Human Mass Spec Standard
CAT#: PH319253
HCST MS Standard C13 and N15-labeled recombinant protein (NP_001007470)
View other "HCST" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | HCST MS Standard C13 and N15-labeled recombinant protein (NP_001007470) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219253 |
| Predicted MW | 9.5 kDa |
| Protein Sequence |
>RC219253 protein sequence
Red=Cloning site Green=Tags(s) MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFL CARPRRSPAQEDGKVYINMPGRG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001007470 |
| RefSeq Size | 521 |
| RefSeq ORF | 279 |
| Synonyms | DAP10; KAP10; PIK3AP |
| Locus ID | 10870 |
| Cytogenetics | 19q13.12 |
| Summary | This gene encodes a transmembrane signaling adaptor that contains a YxxM motif in its cytoplasmic domain. The encoded protein may form part of the immune recognition receptor complex with the C-type lectin-like receptor NKG2D. As part of this receptor complex, this protein may activate phosphatidylinositol 3-kinase dependent signaling pathways through its intracytoplasmic YxxM motif. This receptor complex may have a role in cell survival and proliferation by activation of NK and T cell responses. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402299 | HCST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423490 | HCST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402299 | Transient overexpression lysate of hematopoietic cell signal transducer (HCST), transcript variant 1 |
CNY 3080.00 |
|
| LY423490 | Transient overexpression lysate of hematopoietic cell signal transducer (HCST), transcript variant 2 |
CNY 3080.00 |
|
| TP319253 | Recombinant protein of human hematopoietic cell signal transducer (HCST), transcript variant 2, 20 µg |
CNY 2900.00 |
