IL28B (IFNL3) (NM_172139) Human Recombinant Protein
CAT#: TP318965SE
Purified recombinant protein of Human interleukin 28B (interferon, lambda 3) (IL28B), (Secreted), 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2200.00
货期*
2周
规格
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218965 representing NM_172139
Red=Cloning site Green=Tags(s) MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCK CRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQ PTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.2 kDa |
| Concentration | >50 ug/mL as determined by microplate Bradford method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol |
| Preparation | Conditioned medium was collected from overexpressed HEK293 cells. Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_742151 |
| Locus ID | 282617 |
| UniProt ID | Q8IZI9 |
| Refseq Size | 595 |
| Cytogenetics | 19q13.2 |
| Refseq ORF | 588 |
| Synonyms | IFN-lambda-3; IFN-lambda-4; IL-28B; IL-28C; IL28B; IL28C |
| Summary | This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
