RTKN (NM_001015055) Human Recombinant Protein
CAT＃: TP318810
Recombinant protein of human rhotekin (RTKN), transcript variant 1, 20 µg
View other "RTKN" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218810 protein sequence
Red=Cloning site Green=Tags(s) MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLPEDTELQRKLDHEIRMREGACKLLAACSQREQALE ATKSLLVCNSRILSYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKN KGDLHRWAVFLLLQLGEHIQDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGACVEEEGALTGGP KRLATKLSSSLGRSSGRRVRASLDSAGGSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTL ASHEENPAWLPLYGSVCCRLAAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADT GEEPLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQ WKQCCDEIMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPPPWLAMFTDQP ALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQ SPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 62.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001015055 |
| Locus ID | 6242 |
| UniProt ID | Q9BST9 |
| Refseq Size | 2208 |
| Cytogenetics | 2p13.1 |
| Refseq ORF | 1689 |
| Summary | This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403228 | RTKN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423121 | RTKN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403228 | Transient overexpression lysate of rhotekin (RTKN), transcript variant 2 |
CNY 3080.00 |
|
| LY423121 | Transient overexpression lysate of rhotekin (RTKN), transcript variant 1 |
CNY 4840.00 |
|
| PH304517 | RTKN MS Standard C13 and N15-labeled recombinant protein (NP_149035) |
CNY 19520.00 |
|
| PH318810 | RTKN MS Standard C13 and N15-labeled recombinant protein (NP_001015055) |
CNY 14250.00 |
|
| TP304517 | Recombinant protein of human rhotekin (RTKN), transcript variant 2, 20 µg |
CNY 2900.00 |
