RTKN (NM_033046) Human Mass Spec Standard
CAT＃: PH304517
RTKN MS Standard C13 and N15-labeled recombinant protein (NP_149035)
View other "RTKN" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RTKN MS Standard C13 and N15-labeled recombinant protein (NP_149035) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204517 |
| Predicted MW | 61.2 kDa |
| Protein Sequence |
>RC204517 protein sequence
Red=Cloning site Green=Tags(s) MQDRLHILEDLNMLYIRQMALSLEDTELQRKLDHEIRMREGACKLLAACSQREQALEATKSLLVCNSRIL SYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLL QLGEHIQDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGACVEEEGALTGGPKRLATKLSSSLGR SSGRRVRASLDSAGGSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLY GSVCCRLAAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAVNKE TRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIMKIET PAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAP APDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_149035 |
| RefSeq Size | 2638 |
| RefSeq ORF | 1650 |
| Locus ID | 6242 |
| Cytogenetics | 2p13.1 |
| Summary | This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403228 | RTKN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423121 | RTKN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403228 | Transient overexpression lysate of rhotekin (RTKN), transcript variant 2 |
CNY 3080.00 |
|
| LY423121 | Transient overexpression lysate of rhotekin (RTKN), transcript variant 1 |
CNY 4840.00 |
|
| PH318810 | RTKN MS Standard C13 and N15-labeled recombinant protein (NP_001015055) |
CNY 14250.00 |
|
| TP304517 | Recombinant protein of human rhotekin (RTKN), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP318810 | Recombinant protein of human rhotekin (RTKN), transcript variant 1, 20 µg |
CNY 2900.00 |
