TFIIE alpha (GTF2E1) (NM_005513) Human Recombinant Protein
CAT#: TP318763
Recombinant protein of human general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1), 20 µg
View other "TFIIE alpha" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218763 representing NM_005513
Red=Cloning site Green=Tags(s) MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDK FIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLE ANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTE IPALKQSKDHAATTAGAASLAGGHHREAWATKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIW LRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTAAN GDDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTP EEKEAYIAMGQRMFEDLFE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005504 |
| Locus ID | 2960 |
| UniProt ID | P29083 |
| Refseq Size | 2969 |
| Cytogenetics | 3q13.33 |
| Refseq ORF | 1317 |
| Synonyms | FE; TF2E1; TFIIE-A |
| Summary | Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
| Protein Pathways | Basal transcription factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417254 | GTF2E1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY417254 | Transient overexpression lysate of general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1) |
CNY 4840.00 |
|
| PH318763 | GTF2E1 MS Standard C13 and N15-labeled recombinant protein (NP_005504) |
CNY 19520.00 |
其它TFIIE alpha产品
