Bestrophin 3 (BEST3) (NM_152439) Human Recombinant Protein
CAT#: TP318436
Recombinant protein of human bestrophin 3 (BEST3), transcript variant 2, 20 µg
View other "Bestrophin 3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218436 representing NM_152439
Red=Cloning site Green=Tags(s) MTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGI PLVYTQVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAAD YCIPSFLGSTVQMGLSGSDFPDEEWLWDYEKHGHRHSMIRRVKRFLSAHEHPSSPRRRSYRRQTSDSSMF LPRDDLSPARDLLDVPSRNPPRASPTWKKSCFPEGSPTLHFSMGELSTIRETSQTSTLQSLTPQSSVRTS PIKMPLVPEVLITAAEAPVPTSGGYHHDSATSILSSEFTGVQPSKTEQQQGPMGSILSPSEKETPPGGPS PQTVSASAEENIFNCEEDPGDTFLKRWSLPGFLGSSHTSLGNLSPDPMSSQPALLIDTETSSEISGINIV AGSRVSSDMLYLMENLDTKETDIIELNKETEESPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689652 |
Locus ID | 144453 |
UniProt ID | Q8N1M1 |
Refseq Size | 2898 |
Cytogenetics | 12q15 |
Refseq ORF | 1365 |
Synonyms | VMD2L3 |
Summary | BEST3 belongs to the bestrophin family of anion channels, which includes BEST1 (MIM 607854), the gene mutant in vitelliform macular dystrophy (VMD; MIM 153700), and 2 other BEST1-like genes, BEST2 (MIM 607335) and BEST4 (MIM 607336). Bestrophins are transmembrane (TM) proteins that share a homology region containing a high content of aromatic residues, including an invariant arg-phe-pro (RFP) motif. The bestrophin genes share a conserved gene structure, with almost identical sizes of the 8 RFP-TM domain-encoding exons and highly conserved exon-intron boundaries. Each of the 4 bestrophin genes has a unique 3-prime end of variable length (Stohr et al., 2002 [PubMed 12032738]; Tsunenari et al., 2003 [PubMed 12907679]).[supplied by OMIM, Mar 2008] |
Protein Families | Ion Channels: Other, Transmembrane |
Shipping | Dry Ice |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407540 | BEST3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC409969 | BEST3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY407540 | Transient overexpression lysate of bestrophin 3 (BEST3), transcript variant 2 |
CNY 4840.00 |
|
LY409969 | Transient overexpression lysate of bestrophin 3 (BEST3), transcript variant 1 |
CNY 4840.00 |
|
PH318436 | BEST3 MS Standard C13 and N15-labeled recombinant protein (NP_689652) |
CNY 19520.00 |
其它Bestrophin 3产品