Bestrophin 3 (BEST3) (NM_152439) Human Mass Spec Standard
CAT#: PH318436
BEST3 MS Standard C13 and N15-labeled recombinant protein (NP_689652)
View other "Bestrophin 3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | BEST3 MS Standard C13 and N15-labeled recombinant protein (NP_689652) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218436 |
| Predicted MW | 50.8 kDa |
| Protein Sequence |
>RC218436 representing NM_152439
Red=Cloning site Green=Tags(s) MTTDERKLFNHLKSPHLKYWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGI PLVYTQVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAAD YCIPSFLGSTVQMGLSGSDFPDEEWLWDYEKHGHRHSMIRRVKRFLSAHEHPSSPRRRSYRRQTSDSSMF LPRDDLSPARDLLDVPSRNPPRASPTWKKSCFPEGSPTLHFSMGELSTIRETSQTSTLQSLTPQSSVRTS PIKMPLVPEVLITAAEAPVPTSGGYHHDSATSILSSEFTGVQPSKTEQQQGPMGSILSPSEKETPPGGPS PQTVSASAEENIFNCEEDPGDTFLKRWSLPGFLGSSHTSLGNLSPDPMSSQPALLIDTETSSEISGINIV AGSRVSSDMLYLMENLDTKETDIIELNKETEESPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689652 |
| RefSeq Size | 2898 |
| RefSeq ORF | 1365 |
| Synonyms | VMD2L3 |
| Locus ID | 144453 |
| Cytogenetics | 12q15 |
| Summary | BEST3 belongs to the bestrophin family of anion channels, which includes BEST1 (MIM 607854), the gene mutant in vitelliform macular dystrophy (VMD; MIM 153700), and 2 other BEST1-like genes, BEST2 (MIM 607335) and BEST4 (MIM 607336). Bestrophins are transmembrane (TM) proteins that share a homology region containing a high content of aromatic residues, including an invariant arg-phe-pro (RFP) motif. The bestrophin genes share a conserved gene structure, with almost identical sizes of the 8 RFP-TM domain-encoding exons and highly conserved exon-intron boundaries. Each of the 4 bestrophin genes has a unique 3-prime end of variable length (Stohr et al., 2002 [PubMed 12032738]; Tsunenari et al., 2003 [PubMed 12907679]).[supplied by OMIM, Mar 2008] |
| Protein Families | Ion Channels: Other, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407540 | BEST3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC409969 | BEST3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY407540 | Transient overexpression lysate of bestrophin 3 (BEST3), transcript variant 2 |
CNY 4840.00 |
|
| LY409969 | Transient overexpression lysate of bestrophin 3 (BEST3), transcript variant 1 |
CNY 4840.00 |
|
| TP318436 | Recombinant protein of human bestrophin 3 (BEST3), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Bestrophin 3产品


