HAO2 (NM_001005783) Human Recombinant Protein
CAT＃: TP318416
Purified recombinant protein of Homo sapiens hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2, 20 µg
View other "HAO2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218416 protein sequence
Red=Cloning site Green=Tags(s) MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001005783 |
| Locus ID | 51179 |
| UniProt ID | Q9NYQ3 |
| Refseq Size | 1708 |
| Cytogenetics | 1p12 |
| Refseq ORF | 1053 |
| Synonyms | GIG16; HAOX2 |
| Summary | This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413922 | HAO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423655 | HAO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413922 | Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1 |
CNY 3080.00 |
|
| LY423655 | Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2 |
CNY 3080.00 |
|
| PH305051 | HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_057611) |
CNY 19520.00 |
|
| PH318416 | HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005783) |
CNY 14250.00 |
|
| TP305051 | Recombinant protein of human hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1, 20 µg |
CNY 2900.00 |
