HAO2 (NM_016527) Human Mass Spec Standard
CAT#: PH305051
HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_057611)
View other "HAO2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_057611) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205051 |
| Predicted MW | 38.8 kDa |
| Protein Sequence |
>RC205051 protein sequence
Red=Cloning site Green=Tags(s) MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR L myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057611 |
| RefSeq Size | 1488 |
| RefSeq ORF | 1053 |
| Synonyms | GIG16; HAOX2 |
| Locus ID | 51179 |
| Cytogenetics | 1p12 |
| Summary | This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413922 | HAO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423655 | HAO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413922 | Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1 |
CNY 3080.00 |
|
| LY423655 | Transient overexpression lysate of hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2 |
CNY 3080.00 |
|
| PH318416 | HAO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005783) |
CNY 14250.00 |
|
| TP305051 | Recombinant protein of human hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP318416 | Purified recombinant protein of Homo sapiens hydroxyacid oxidase 2 (long chain) (HAO2), transcript variant 2, 20 µg |
CNY 2900.00 |
