IL17 (IL17A) (NM_002190) Human Recombinant Protein
CAT#: TP318057
Recombinant protein of human interleukin 17A (IL17A), 20 µg
View other "IL17" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 2700.00
CNY 3790.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218057 representing NM_002190
Red=Cloning site Green=Tags(s) MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRS TSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILV SVGCTCVTPIVHHVA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002181 |
| Locus ID | 3605 |
| UniProt ID | Q16552 |
| Refseq Size | 1859 |
| Cytogenetics | 6p12.2 |
| Refseq ORF | 465 |
| Synonyms | CTLA-8; CTLA8; IL-17; IL-17A; IL17; ILA17 |
| Summary | This gene is a member of the IL-17 receptor family which includes five members (IL-17RA-E) and the encoded protein is a proinflammatory cytokine produced by activated T cells. IL-17A-mediated downstream pathways induce the production of inflammatory molecules, chemokines, antimicrobial peptides, and remodeling proteins. The encoded protein elicits crucial impacts on host defense, cell trafficking, immune modulation, and tissue repair, with a key role in the induction of innate immune defenses. This cytokine stimulates non-hematopoietic cells and promotes chemokine production thereby attracting myeloid cells to inflammatory sites. This cytokine also regulates the activities of NF-kappaB and mitogen-activated protein kinases and can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). IL-17A plays a pivotal role in various infectious diseases, inflammatory and autoimmune disorders, and cancer. High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The lung damage induced by the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is to a large extent, a result of the inflammatory response promoted by cytokines such as IL17A. [provided by RefSeq, Sep 2020] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400795 | IL17A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400795 | Transient overexpression lysate of interleukin 17A (IL17A) |
CNY 3080.00 |
|
| PH318057 | IL17A MS Standard C13 and N15-labeled recombinant protein (NP_002181) |
CNY 19520.00 |
|
| TP720016 | Recombinant protein of human interleukin 17A (IL17A) |
CNY 1800.00 |
|
| TP721376 | Recombinant mouse IL-17A protein |
CNY 1688.00 |
|
| TP723711 | Purified recombinant protein of Human interleukin 17A (IL17A) |
CNY 4090.00 |
|
| TP723780 | Purified recombinant protein of Human interleukin 17A and 17F (IL17A / IL-17F) heterodimer |
CNY 6910.00 |
|
| TP762309 | Purified recombinant protein of Human interleukin 17A (IL17A), Gly24-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |

