AGRP (NM_001138) Human Recombinant Protein
CAT#: TP317144
Recombinant protein of human agouti related protein homolog (mouse) (AGRP), transcript variant 1, 20 µg
View other "AGRP" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217144 protein sequence
Red=Cloning site Green=Tags(s) MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQAL AEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001129 |
| Locus ID | 181 |
| UniProt ID | O00253 |
| Refseq Size | 783 |
| Cytogenetics | 16q22.1 |
| Refseq ORF | 396 |
| Synonyms | AGRT; ART; ASIP2 |
| Summary | This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. [provided by RefSeq, Dec 2009] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Adipocytokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416046 | AGRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420100 | AGRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416046 | Transient overexpression lysate of agouti related protein homolog (mouse) (AGRP), transcript variant 2 |
CNY 3080.00 |
|
| LY420100 | Transient overexpression lysate of agouti related protein homolog (mouse) (AGRP) |
CNY 3080.00 |
|
| PH317144 | AGRP MS Standard C13 and N15-labeled recombinant protein (NP_001129) |
CNY 19520.00 |
