HCK (NM_002110) Human Recombinant Protein
CAT#: TP317022
Recombinant protein of human hemopoietic cell kinase (HCK), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217022 representing NM_002110
Red=Cloning site Green=Tags(s) MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNT PGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLE TEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYI SPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMAT YNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEG SKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIM MRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002101 |
| Locus ID | 3055 |
| UniProt ID | P08631 |
| Refseq Size | 2168 |
| Cytogenetics | 20q11.21 |
| Refseq ORF | 1578 |
| Synonyms | JTK9; p59Hck; p61Hck |
| Summary | The protein encoded by this gene is a member of the Src family of tyrosine kinases. This protein is primarily hemopoietic, particularly in cells of the myeloid and B-lymphoid lineages. It may help couple the Fc receptor to the activation of the respiratory burst. In addition, it may play a role in neutrophil migration and in the degranulation of neutrophils. Multiple isoforms with different subcellular distributions are produced due to both alternative splicing and the use of alternative translation initiation codons, including a non-AUG (CUG) codon. [provided by RefSeq, Feb 2010] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Chemokine signaling pathway, Fc gamma R-mediated phagocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419528 | HCK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433198 | HCK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433231 | HCK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419528 | Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 1 |
CNY 3080.00 |
|
| LY433198 | Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 3 |
CNY 3080.00 |
|
| LY433231 | Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 2 |
CNY 3080.00 |
|
| PH317022 | HCK MS Standard C13 and N15-labeled recombinant protein (NP_002101) |
CNY 19520.00 |


