HCK (NM_002110) Human Mass Spec Standard
CAT#: PH317022
HCK MS Standard C13 and N15-labeled recombinant protein (NP_002101)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HCK MS Standard C13 and N15-labeled recombinant protein (NP_002101) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217022 |
| Predicted MW | 59.6 kDa |
| Protein Sequence |
>RC217022 representing NM_002110
Red=Cloning site Green=Tags(s) MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNT PGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLE TEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYI SPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMAT YNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEG SKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIM MRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002101 |
| RefSeq Size | 2168 |
| RefSeq ORF | 1578 |
| Synonyms | JTK9; p59Hck; p61Hck |
| Locus ID | 3055 |
| Cytogenetics | 20q11.21 |
| Summary | The protein encoded by this gene is a member of the Src family of tyrosine kinases. This protein is primarily hemopoietic, particularly in cells of the myeloid and B-lymphoid lineages. It may help couple the Fc receptor to the activation of the respiratory burst. In addition, it may play a role in neutrophil migration and in the degranulation of neutrophils. Multiple isoforms with different subcellular distributions are produced due to both alternative splicing and the use of alternative translation initiation codons, including a non-AUG (CUG) codon. [provided by RefSeq, Feb 2010] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Chemokine signaling pathway, Fc gamma R-mediated phagocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419528 | HCK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433198 | HCK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433231 | HCK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419528 | Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 1 |
CNY 3080.00 |
|
| LY433198 | Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 3 |
CNY 3080.00 |
|
| LY433231 | Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 2 |
CNY 3080.00 |
|
| TP317022 | Recombinant protein of human hemopoietic cell kinase (HCK), 20 µg |
CNY 2900.00 |


