PMPCA (NM_015160) Human Recombinant Protein
CAT#: TP317017
Recombinant protein of human peptidase (mitochondrial processing) alpha (PMPCA), nuclear gene encoding mitochondrial protein, 20 µg
View other "PMPCA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217017 representing NM_015160
Red=Cloning site Green=Tags(s) MAAVVLAATRLLRGSGSWGCSRLRFGPPAYRRFSSGGAYPNIPLSSPLPGVPKPVFATVDGQEKFETKVT TLDNGLRVASQNKFGQFCTVGILINSGSRYEAKYLSGIAHFLEKLAFSSTARFDSKDEILLTLEKHGGIC YCQTSRDTTMYAVSADSKGLDTVVALLADVVLQPRLTDEEVEMTRMAVQFELEDLNLRPDPEPLLTEMIH EAAYRENTVGLHRFCPTENVAKINREVLHSYLRNYYTPDRMVLAGVGVEHEHLVDCARKYLLGVQPAWGS AEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSF SAGGPGKGMFSRLYLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQVREMVEIITKEFILMGGTVD TVELERAKTQLTSMLMMNLESRPVIFEDVGRQVLATRSRKLPHELCTLIRNVKPEDVKRVASKMLRGKPA VAALGDLTDLPTYEHIQTALSSKDGRLPRTYRLFR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 58.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055975 |
| Locus ID | 23203 |
| UniProt ID | Q10713 |
| Refseq Size | 2097 |
| Cytogenetics | 9q34.3 |
| Refseq ORF | 1575 |
| Synonyms | Alpha-MPP; CLA1; CPD3; INPP5E; MAS2; P-55; SCAR2 |
| Summary | The protein encoded by this gene is found in the mitochondrion, where it represents the alpha subunit of a proteolytic heterodimer. This heterodimer is responsible for cleaving the transit peptide from nuclear-encoded mitochondrial proteins. Defects in this gene are a cause of spinocerebellar ataxia, autosomal recessive 2. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome, Protease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414752 | PMPCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY414752 | Transient overexpression lysate of peptidase (mitochondrial processing) alpha (PMPCA), nuclear gene encoding mitochondrial protein |
CNY 4840.00 |
|
| PH317017 | PMPCA MS Standard C13 and N15-labeled recombinant protein (NP_055975) |
CNY 19520.00 |
