PMPCA Rabbit Polyclonal Antibody
CAT#: TA331965
Rabbit Polyclonal Anti-PMPCA Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-PMPCA Antibody is: synthetic peptide directed towards the C-terminal region of Human PMPCA. Synthetic peptide located within the following region: IRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLP |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 54 kDa |
| Gene Name | peptidase, mitochondrial processing alpha subunit |
| Database Link | |
| Background | PMPCA cleaves presequences (transit peptides) from mitochondrial protein precursors. |
| Synonyms | Alpha-MPP; INPP5E; P-55; SCAR2 |
| Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Horse: 92%; Bovine: 86%; Pig: 79%; Guinea pig: 79%; Dog: 77% |
| Reference Data | |
| Protein Families | Druggable Genome, Protease |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
