GALK2 (NM_001001556) Human Recombinant Protein
CAT#: TP316527
Recombinant protein of human galactokinase 2 (GALK2), transcript variant 2, 20 µg
View other "GALK2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216527 representing NM_001001556
Red=Cloning site Green=Tags(s) MPVLYDRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIAVEPVKTYALQL ANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPPSSGLSSSSALV CCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGA VFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYKSLQWDKVLRLEEVQAKLGISLEEMLLVTEDALH PEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICEEAPENMVQLLG ELMNQSHMSCRDMYECSCPELDQLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQR SDGSLAPEKQSLFATKPGGGALVLLEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001001556 |
| Locus ID | 2585 |
| UniProt ID | Q01415 |
| Refseq Size | 3208 |
| Cytogenetics | 15q21.1-q21.2 |
| Refseq ORF | 1341 |
| Synonyms | GK2 |
| Summary | This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. The encoded protein is a member of the GHMP kinase family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400749 | GALK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424379 | GALK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400749 | Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 1 |
CNY 3080.00 |
|
| LY424379 | Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 2 |
CNY 4840.00 |
|
| PH300475 | GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_002035) |
CNY 19520.00 |
|
| PH316527 | GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_001001556) |
CNY 19520.00 |
|
| TP300475 | Recombinant protein of human galactokinase 2 (GALK2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP721055 | Purified recombinant protein of Human galactokinase 2 (GALK2), transcript variant 1 |
CNY 1800.00 |
