GALK2 (NM_002044) Human Mass Spec Standard
CAT＃: PH300475
GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_002035)
View other "GALK2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_002035) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200475 |
| Predicted MW | 50.4 kDa |
| Protein Sequence |
>RC200475 protein sequence
Red=Cloning site Green=Tags(s) MATESPATRRVQVAEHPRLLKLKEMFNSKFGSIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIA VEPVKTYALQLANTNPLYPDFSTSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPP SSGLSSSSALVCCAGLVTLTVLGRNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPL RATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYKSLQWDKVLRLEEVQAKLGISLE EMLLVTEDALHPEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVLQFKKICE EAPENMVQLLGELMNQSHMSCRDMYECSCPELDQLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSF LANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLEA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002035 |
| RefSeq Size | 3330 |
| RefSeq ORF | 1374 |
| Synonyms | GK2 |
| Locus ID | 2585 |
| Cytogenetics | 15q21.1-q21.2 |
| Summary | This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. The encoded protein is a member of the GHMP kinase family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400749 | GALK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424379 | GALK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400749 | Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 1 |
CNY 3080.00 |
|
| LY424379 | Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 2 |
CNY 4840.00 |
|
| PH316527 | GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_001001556) |
CNY 19520.00 |
|
| TP300475 | Recombinant protein of human galactokinase 2 (GALK2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP316527 | Recombinant protein of human galactokinase 2 (GALK2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP721055 | Purified recombinant protein of Human galactokinase 2 (GALK2), transcript variant 1 |
CNY 1800.00 |
