GALP (NM_033106) Human Recombinant Protein
CAT#: TP316301
Recombinant protein of human galanin-like peptide (GALP), transcript variant 1, 20 µg
View other "GALP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216301 representing NM_033106
Red=Cloning site Green=Tags(s) MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWK AIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_149097 |
| Locus ID | 85569 |
| UniProt ID | Q9UBC7 |
| Refseq Size | 947 |
| Cytogenetics | 19q13.43 |
| Refseq ORF | 348 |
| Summary | This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, has vasoactive properties, displays antimicrobial activity against E. coli, and may serve as a marker for neuroblastic tumors.[provided by RefSeq, Nov 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403225 | GALP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403225 | Transient overexpression lysate of galanin-like peptide (GALP), transcript variant 1 |
CNY 3080.00 |
|
| PH316301 | GALP MS Standard C13 and N15-labeled recombinant protein (NP_149097) |
CNY 19520.00 |
