GALP (NM_033106) Human Mass Spec Standard
CAT#: PH316301
GALP MS Standard C13 and N15-labeled recombinant protein (NP_149097)
View other "GALP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | GALP MS Standard C13 and N15-labeled recombinant protein (NP_149097) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216301 |
Predicted MW | 12.4 kDa |
Protein Sequence |
>RC216301 representing NM_033106
Red=Cloning site Green=Tags(s) MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWK AIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_149097 |
RefSeq Size | 947 |
RefSeq ORF | 348 |
Locus ID | 85569 |
Cytogenetics | 19q13.43 |
Summary | This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, has vasoactive properties, displays antimicrobial activity against E. coli, and may serve as a marker for neuroblastic tumors.[provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403225 | GALP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403225 | Transient overexpression lysate of galanin-like peptide (GALP), transcript variant 1 |
CNY 3080.00 |
|
TP316301 | Recombinant protein of human galanin-like peptide (GALP), transcript variant 1, 20 µg |
CNY 2900.00 |