C18orf1 (LDLRAD4) (NM_181483) Human Recombinant Protein
CAT#: TP315558
Purified recombinant protein of Homo sapiens chromosome 18 open reading frame 1 (C18orf1), transcript variant b2, 20 µg
View other "C18orf1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215558 representing NM_181483
Red=Cloning site Green=Tags(s) MAAELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQIMHAPRSRDRFTAPSF IQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDS DLIDIAMYSGGPCPPSSNSGISASTCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSRLQFQQN NAESTIVPIKGKDRKPGNLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_852148 |
Locus ID | 753 |
UniProt ID | O15165 |
Refseq Size | 8031 |
Cytogenetics | 18p11.21 |
Refseq ORF | 690 |
Synonyms | C18orf1 |
Summary | Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYVE9/SARA recruits the intracellular signal transducer and transcriptional modulators SMAD2 and SMAD3 to the TGF-beta receptor. Phosphorylated by the receptor, SMAD2 and SMAD3 then form a heteromeric complex with SMAD4 that translocates to the nucleus to regulate transcription. Through interaction with SMAD2 and SMAD3, LDLRAD4 may compete with ZFYVE9 and SMAD4 and prevent propagation of the intracellular signal.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405781 | LDLRAD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418054 | LDLRAD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424094 | LDLRAD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405781 | Transient overexpression lysate of chromosome 18 open reading frame 1 (C18orf1), transcript variant b2 |
CNY 3080.00 |
|
LY418054 | Transient overexpression lysate of chromosome 18 open reading frame 1 (C18orf1), transcript variant b1 |
CNY 3080.00 |
|
LY424094 | Transient overexpression lysate of chromosome 18 open reading frame 1 (C18orf1), transcript variant c1 |
CNY 3080.00 |
|
PH315558 | C18orf1 MS Standard C13 and N15-labeled recombinant protein (NP_852148) |
CNY 14250.00 |
其它C18orf1产品