C18orf1 (LDLRAD4) (NM_181483) Human Mass Spec Standard
CAT#: PH315558
C18orf1 MS Standard C13 and N15-labeled recombinant protein (NP_852148)
View other "C18orf1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | C18orf1 MS Standard C13 and N15-labeled recombinant protein (NP_852148) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215558 |
| Predicted MW | 25.6 kDa |
| Protein Sequence |
>RC215558 representing NM_181483
Red=Cloning site Green=Tags(s) MAAELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQIMHAPRSRDRFTAPSF IQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDS DLIDIAMYSGGPCPPSSNSGISASTCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSRLQFQQN NAESTIVPIKGKDRKPGNLV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_852148 |
| RefSeq Size | 8031 |
| RefSeq ORF | 690 |
| Synonyms | C18orf1 |
| Locus ID | 753 |
| Cytogenetics | 18p11.21 |
| Summary | Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYVE9/SARA recruits the intracellular signal transducer and transcriptional modulators SMAD2 and SMAD3 to the TGF-beta receptor. Phosphorylated by the receptor, SMAD2 and SMAD3 then form a heteromeric complex with SMAD4 that translocates to the nucleus to regulate transcription. Through interaction with SMAD2 and SMAD3, LDLRAD4 may compete with ZFYVE9 and SMAD4 and prevent propagation of the intracellular signal.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405781 | LDLRAD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418054 | LDLRAD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424094 | LDLRAD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405781 | Transient overexpression lysate of chromosome 18 open reading frame 1 (C18orf1), transcript variant b2 |
CNY 3080.00 |
|
| LY418054 | Transient overexpression lysate of chromosome 18 open reading frame 1 (C18orf1), transcript variant b1 |
CNY 3080.00 |
|
| LY424094 | Transient overexpression lysate of chromosome 18 open reading frame 1 (C18orf1), transcript variant c1 |
CNY 3080.00 |
|
| TP315558 | Purified recombinant protein of Homo sapiens chromosome 18 open reading frame 1 (C18orf1), transcript variant b2, 20 µg |
CNY 2900.00 |
其它C18orf1产品
