CAPS (NM_080590) Human Recombinant Protein
CAT#: TP315422
Recombinant protein of human calcyphosine (CAPS), transcript variant 2, 20 µg
View other "CAPS" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215422 representing NM_080590
Red=Cloning site Green=Tags(s) MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVTLAEFQDYYS GVSASMNTDEEFVAMMTSAWQL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_542157 |
| Locus ID | 828 |
| UniProt ID | Q13938 |
| Refseq Size | 1166 |
| Cytogenetics | 19p13.3 |
| Refseq ORF | 486 |
| Synonyms | CAPS1 |
| Summary | This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409138 | CAPS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418250 | CAPS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409138 | Transient overexpression lysate of calcyphosine (CAPS), transcript variant 2 |
CNY 3080.00 |
|
| LY418250 | Transient overexpression lysate of calcyphosine (CAPS), transcript variant 1 |
CNY 3080.00 |
|
| PH310271 | CAPS MS Standard C13 and N15-labeled recombinant protein (NP_004049) |
CNY 19520.00 |
|
| PH315422 | CAPS MS Standard C13 and N15-labeled recombinant protein (NP_542157) |
CNY 19520.00 |
|
| TP310271 | Recombinant protein of human calcyphosine (CAPS), transcript variant 1, 20 µg |
CNY 2900.00 |
