CAPS (NM_080590) Human Mass Spec Standard
CAT#: PH315422
CAPS MS Standard C13 and N15-labeled recombinant protein (NP_542157)
View other "CAPS" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CAPS MS Standard C13 and N15-labeled recombinant protein (NP_542157) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215422 |
| Predicted MW | 17.6 kDa |
| Protein Sequence |
>RC215422 representing NM_080590
Red=Cloning site Green=Tags(s) MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWD RNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVTLAEFQDYYS GVSASMNTDEEFVAMMTSAWQL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_542157 |
| RefSeq Size | 1166 |
| RefSeq ORF | 486 |
| Synonyms | CAPS1 |
| Locus ID | 828 |
| Cytogenetics | 19p13.3 |
| Summary | This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409138 | CAPS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418250 | CAPS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409138 | Transient overexpression lysate of calcyphosine (CAPS), transcript variant 2 |
CNY 3080.00 |
|
| LY418250 | Transient overexpression lysate of calcyphosine (CAPS), transcript variant 1 |
CNY 3080.00 |
|
| PH310271 | CAPS MS Standard C13 and N15-labeled recombinant protein (NP_004049) |
CNY 19520.00 |
|
| TP310271 | Recombinant protein of human calcyphosine (CAPS), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP315422 | Recombinant protein of human calcyphosine (CAPS), transcript variant 2, 20 µg |
CNY 2900.00 |
