HDAC9 (NM_014707) Human Recombinant Protein
CAT#: TP315267
Recombinant protein of human histone deacetylase 9 (HDAC9), transcript variant 3, 20 µg
View other "HDAC9" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215267 representing NM_014707
Red=Cloning site Green=Tags(s) MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQK QHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVAS TEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDAK DDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNN GPTGSVTENETSVLPPTPHAEQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEK QKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSK SIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQI QEMESGEQAAFMQQVIGKDLAPGFVIKVII myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 65.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055522 |
| Locus ID | 9734 |
| UniProt ID | Q9UKV0 |
| Refseq Size | 4238 |
| Cytogenetics | 7p21.1 |
| Refseq ORF | 1770 |
| Synonyms | HD7; HD7b; HD9; HDAC; HDAC7; HDAC7B; HDAC9B; HDAC9FL; HDRP; MITR |
| Summary | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403601 | HDAC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC415085 | HDAC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403601 | Transient overexpression lysate of histone deacetylase 9 (HDAC9), transcript variant 4 |
CNY 4840.00 |
|
| LY415085 | Transient overexpression lysate of histone deacetylase 9 (HDAC9), transcript variant 3 |
CNY 4840.00 |
|
| PH315267 | HDAC9 MS Standard C13 and N15-labeled recombinant protein (NP_055522) |
CNY 19520.00 |


