HDAC9 (NM_014707) Human Mass Spec Standard
CAT#: PH315267
HDAC9 MS Standard C13 and N15-labeled recombinant protein (NP_055522)
View other "HDAC9" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | HDAC9 MS Standard C13 and N15-labeled recombinant protein (NP_055522) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215267 |
| Predicted MW | 65.7 kDa |
| Protein Sequence |
>RC215267 representing NM_014707
Red=Cloning site Green=Tags(s) MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQK QHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVAS TEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDAK DDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNN GPTGSVTENETSVLPPTPHAEQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEK QKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSK SIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQI QEMESGEQAAFMQQVIGKDLAPGFVIKVII myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055522 |
| RefSeq Size | 4238 |
| RefSeq ORF | 1770 |
| Synonyms | HD7; HD7b; HD9; HDAC; HDAC7; HDAC7B; HDAC9B; HDAC9FL; HDRP; MITR |
| Locus ID | 9734 |
| Cytogenetics | 7p21.1 |
| Summary | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403601 | HDAC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC415085 | HDAC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403601 | Transient overexpression lysate of histone deacetylase 9 (HDAC9), transcript variant 4 |
CNY 4840.00 |
|
| LY415085 | Transient overexpression lysate of histone deacetylase 9 (HDAC9), transcript variant 3 |
CNY 4840.00 |
|
| TP315267 | Recombinant protein of human histone deacetylase 9 (HDAC9), transcript variant 3, 20 µg |
CNY 2900.00 |


