BATF3 (NM_018664) Human Recombinant Protein
CAT#: TP315000
Recombinant protein of human basic leucine zipper transcription factor, ATF-like 3 (BATF3), 20 µg
View other "BATF3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215000 protein sequence
Red=Cloning site Green=Tags(s) MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESL EQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061134 |
Locus ID | 55509 |
UniProt ID | Q9NR55 |
Refseq Size | 992 |
Cytogenetics | 1q32.3 |
Refseq ORF | 381 |
Synonyms | JDP1; JUNDM1; SNFT |
Summary | This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.[provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412970 | BATF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412970 | Transient overexpression lysate of basic leucine zipper transcription factor, ATF-like 3 (BATF3) |
CNY 3080.00 |
|
PH315000 | BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134) |
CNY 19520.00 |