BATF3 (NM_018664) Human Mass Spec Standard
CAT#: PH315000
BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134)
View other "BATF3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215000 |
Predicted MW | 14.5 kDa |
Protein Sequence |
>RC215000 protein sequence
Red=Cloning site Green=Tags(s) MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESL EQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061134 |
RefSeq Size | 992 |
RefSeq ORF | 381 |
Synonyms | JDP1; JUNDM1; SNFT |
Locus ID | 55509 |
Cytogenetics | 1q32.3 |
Summary | This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.[provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412970 | BATF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412970 | Transient overexpression lysate of basic leucine zipper transcription factor, ATF-like 3 (BATF3) |
CNY 3080.00 |
|
TP315000 | Recombinant protein of human basic leucine zipper transcription factor, ATF-like 3 (BATF3), 20 µg |
CNY 2900.00 |