RANBP3 (NM_007322) Human Recombinant Protein
CAT#: TP314493
Purified recombinant protein of Homo sapiens RAN binding protein 3 (RANBP3), transcript variant RANBP3-d, 20 µg
View other "RANBP3" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214493 representing NM_007322
Red=Cloning site Green=Tags(s) MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHGTGHPESAGEHALEPPAPAG ASASTPPPPAPEAQLPPFPRELAGRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLTQFPPSQSEERSS GFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKALSQTVPSSGTNGVSLPADCTGAVPAA SPDTAAWRSPSEAADEVCALEEKEPQKNESSNASEEEACEKKDPATQQAFVFGQNLRDRVKLINESVDEA DMENAGHPSADTPTATNYFLQYISSSLENSTNSADASSNKFVFGQNMSERVLSPPKLNEVSSDANRENAA AESGSESSSQEATPEKESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVE RGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVFLI SASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEEDDSDDDDVLAPSGATAAGAGDEGD GQTTGST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 60 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_015561 |
| Locus ID | 8498 |
| UniProt ID | Q9H6Z4 |
| Refseq Size | 2439 |
| Cytogenetics | 19p13.3 |
| Refseq ORF | 1701 |
| Summary | This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416048 | RANBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC416049 | RANBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC418541 | RANBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY416048 | Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-b |
CNY 4840.00 |
|
| LY416049 | Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-d |
CNY 4840.00 |
|
| LY418541 | Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-a |
CNY 4840.00 |
|
| PH314493 | RANBP3 MS Standard C13 and N15-labeled recombinant protein (NP_015561) |
CNY 14250.00 |
|
| PH324944 | RANBP3 MS Standard C13 and N15-labeled recombinant protein (NP_015559) |
CNY 14250.00 |
|
| TP324944 | Recombinant protein of human RAN binding protein 3 (RANBP3), transcript variant RANBP3-b, 20 µg |
CNY 2900.00 |
