RANBP3 Rabbit Polyclonal Antibody
CAT#: TA344302
Rabbit Polyclonal Anti-RANBP3 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
CNY 9998.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RANBP3 antibody: synthetic peptide directed towards the N terminal of human RANBP3. Synthetic peptide located within the following region: MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 62 kDa |
Gene Name | RAN binding protein 3 |
Database Link | |
Background | RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Synonyms | DKFZp586I1520 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Rabbit: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |