RANBP3 Rabbit Polyclonal Antibody

CAT#: TA344302

Rabbit Polyclonal Anti-RANBP3 Antibody - N-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Purified recombinant protein of Homo sapiens RAN binding protein 3 (RANBP3), transcript variant RANBP3-d, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-a
    • 100 ug

CNY 4840.00


Purified recombinant protein of Homo sapiens RAN binding protein 3 (RANBP3), transcript variant RANBP3-d, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-d
    • 100 ug

CNY 4840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RANBP3 antibody: synthetic peptide directed towards the N terminal of human RANBP3. Synthetic peptide located within the following region: MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 62 kDa
Gene Name RAN binding protein 3
Background RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Synonyms DKFZp586I1520
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Rabbit: 86%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...