CNBP (NM_003418) Human Recombinant Protein
CAT＃: TP314473
Recombinant protein of human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, 20 µg
View other "CNBP" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214473 representing NM_003418
Red=Cloning site Green=Tags(s) MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQ EDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRC GETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003409 |
| Locus ID | 7555 |
| UniProt ID | P62633 |
| Refseq Size | 1500 |
| Cytogenetics | 3q21.3 |
| Refseq ORF | 531 |
| Synonyms | CNBP1; DM2; PROMM; RNF163; ZCCHC22; ZNF9 |
| Summary | This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion from <30 repeats to 75-11000 repeats in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2016] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418710 | CNBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426696 | CNBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426700 | CNBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418710 | Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3 |
CNY 3080.00 |
|
| LY426696 | Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 1 |
CNY 3080.00 |
|
| LY426700 | Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6 |
CNY 3080.00 |
|
| PH314473 | CNBP MS Standard C13 and N15-labeled recombinant protein (NP_003409) |
CNY 19520.00 |
|
| PH325167 | CNBP MS Standard C13 and N15-labeled recombinant protein (NP_001120668) |
CNY 14250.00 |
|
| TP325167 | Purified recombinant protein of Homo sapiens CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6, 20 µg |
CNY 2900.00 |
