CNBP (NM_003418) Human Mass Spec Standard
CAT#: PH314473
CNBP MS Standard C13 and N15-labeled recombinant protein (NP_003409)
View other "CNBP" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CNBP MS Standard C13 and N15-labeled recombinant protein (NP_003409) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214473 |
| Predicted MW | 19.3 kDa |
| Protein Sequence |
>RC214473 representing NM_003418
Red=Cloning site Green=Tags(s) MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQ EDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRC GETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003409 |
| RefSeq Size | 1500 |
| RefSeq ORF | 531 |
| Synonyms | CNBP1; DM2; PROMM; RNF163; ZCCHC22; ZNF9 |
| Locus ID | 7555 |
| Cytogenetics | 3q21.3 |
| Summary | This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion from <30 repeats to 75-11000 repeats in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2016] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418710 | CNBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426696 | CNBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426700 | CNBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418710 | Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3 |
CNY 3080.00 |
|
| LY426696 | Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 1 |
CNY 3080.00 |
|
| LY426700 | Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6 |
CNY 3080.00 |
|
| PH325167 | CNBP MS Standard C13 and N15-labeled recombinant protein (NP_001120668) |
CNY 14250.00 |
|
| TP314473 | Recombinant protein of human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP325167 | Purified recombinant protein of Homo sapiens CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6, 20 µg |
CNY 2900.00 |
