CABP5 (NM_019855) Human Recombinant Protein
CAT#: TP313946
Recombinant protein of human calcium binding protein 5 (CABP5), 20 µg
View other "CABP5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213946 protein sequence
Red=Cloning site Green=Tags(s) MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELI ELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGE RLTPREISEVVREADVNGDGTVDFEEFVKMMSR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062829 |
Locus ID | 56344 |
UniProt ID | Q9NP86 |
Refseq Size | 1845 |
Cytogenetics | 19q13.33 |
Refseq ORF | 519 |
Synonyms | CABP3 |
Summary | The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene is retina-specific. The mouse homolog of this protein has been shown to express in the inner nuclear layer of the retina, suggested its role in neuronal functioning. The specific function of this gene is unknown. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412686 | CABP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412686 | Transient overexpression lysate of calcium binding protein 5 (CABP5) |
CNY 3080.00 |
|
PH313946 | CABP5 MS Standard C13 and N15-labeled recombinant protein (NP_062829) |
CNY 19520.00 |