CABP5 (NM_019855) Human Mass Spec Standard
CAT#: PH313946
CABP5 MS Standard C13 and N15-labeled recombinant protein (NP_062829)
View other "CABP5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CABP5 MS Standard C13 and N15-labeled recombinant protein (NP_062829) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213946 |
Predicted MW | 19.8 kDa |
Protein Sequence |
>RC213946 protein sequence
Red=Cloning site Green=Tags(s) MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELI ELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGE RLTPREISEVVREADVNGDGTVDFEEFVKMMSR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_062829 |
RefSeq Size | 1845 |
RefSeq ORF | 519 |
Synonyms | CABP3 |
Locus ID | 56344 |
Cytogenetics | 19q13.33 |
Summary | The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene is retina-specific. The mouse homolog of this protein has been shown to express in the inner nuclear layer of the retina, suggested its role in neuronal functioning. The specific function of this gene is unknown. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412686 | CABP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412686 | Transient overexpression lysate of calcium binding protein 5 (CABP5) |
CNY 3080.00 |
|
TP313946 | Recombinant protein of human calcium binding protein 5 (CABP5), 20 µg |
CNY 2900.00 |