Tau (MAPT) (NM_016841) Human Recombinant Protein
CAT#: TP313364
Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 4, 20 µg
View other "Tau" proteins (17)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213364 representing NM_016841
Red=Cloning site Green=Tags(s) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMV SKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYS SPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKH QPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNK KIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQ GL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_058525 |
Locus ID | 4137 |
UniProt ID | P10636 |
Refseq Size | 2529 |
Cytogenetics | 17q21.31 |
Refseq ORF | 1056 |
Synonyms | DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU; tau-40 |
Summary | This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401790 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC413819 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413820 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC413823 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426599 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429527 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY401790 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 2 |
CNY 4840.00 |
|
LY413819 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 3 |
CNY 3080.00 |
|
LY413820 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 1 |
CNY 4840.00 |
|
LY413823 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 4 |
CNY 3080.00 |
|
LY426599 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 5 |
CNY 3080.00 |
|
PH313312 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_005901) |
CNY 19520.00 |
|
PH313364 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058525) |
CNY 19520.00 |
|
PH317773 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058518) |
CNY 19520.00 |
|
TP313312 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP317773 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP720155 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 6 |
CNY 1800.00 |