Tau (MAPT) (NM_016841) Human Mass Spec Standard
CAT#: PH313364
MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058525)
View other "Tau" proteins (17)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058525) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213364 |
| Predicted MW | 36.6 kDa |
| Protein Sequence |
>RC213364 representing NM_016841
Red=Cloning site Green=Tags(s) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMV SKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYS SPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKH QPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNK KIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQ GL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_058525 |
| RefSeq Size | 2529 |
| RefSeq ORF | 1056 |
| Synonyms | DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU; tau-40 |
| Locus ID | 4137 |
| Cytogenetics | 17q21.31 |
| Summary | This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alzheimer's disease, MAPK signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401790 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC413819 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413820 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC413823 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426599 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429527 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401790 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 2 |
CNY 4840.00 |
|
| LY413819 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 3 |
CNY 3080.00 |
|
| LY413820 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 1 |
CNY 4840.00 |
|
| LY413823 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 4 |
CNY 3080.00 |
|
| LY426599 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 5 |
CNY 3080.00 |
|
| PH313312 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_005901) |
CNY 19520.00 |
|
| PH317773 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058518) |
CNY 19520.00 |
|
| TP313312 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP313364 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP317773 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP720155 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 6 |
CNY 1800.00 |


